Site title of www.timesofmalta.com is timesofmalta.com - General, sporting, and business news for Malta and the surrounding region

World ranking 4815 altough the site value is $466392. timesofmalta.com IP is 104.20.59.125 on cloudflare-nginx server works with 157 ms speed. The charset for this site is utf-8.

Web site description for timesofmalta.com is

GENERAL INFORMATION

Site Title timesofmalta.com - General, sporting, and business news for Malta and the surrounding region
Charset utf-8
Page Speed 157 ms
Site Host www.timesofmalta.com
IP Address 104.20.59.125
Site Server cloudflare-nginx
Site Language en
Alexa Rank 4815

Search Engine Indexes

Google Indexed PagesNot Detect
Yahoo Indexed PagesNot Detect
Bing Indexed PagesNot Detect

Search Engine Backlinks

Google BacklinksNot Detect
Bing BacklinksNot Detect
Alexa BackLinksNot Detect

Safety Information

Google Safe BrowsingNo Risk Issues
Siteadvisor RatingNot Detect
WOT TrustworthinessExcellent
WOT PrivacyExcellent
WOT Child SafetyGood

Website Ranks & Scores

Google Pagerank-
Alexa Rank4815
Domain AuthorityNot Detect
DMOZ ListingNo

LINK ANALYSE

Text Link Rel Target
world news/sections/view/world
world/sections/view/world
wisdom of the heart/articles/view/20161002/opinion/wisdom-of-the-heart.626675
what students want/articles/view/20161002/life-features/what-students-want.626742
what is fitness, exactly?/articles/view/20161002/health-fitness/what-is-fitness-exactly.626744
webcam/services/webcam
weather/weather/forecast
waterpolo/sections/view/waterpolo
watch: trump blames.../articles/view/20161001/world/watch-trump-blames-microphone-as-clinton-takes-poll-lead.626644
watch: rescuer breaks into.../articles/view/20161001/world/watch-rescuer-breaks-into-tears-as-he-rescues-toddler-from-syria.626651
watch: man destroys iphones at apple.../articles/view/20161001/odd-news/customer-destroys-iphones-at-apple-store-for-being-let-down-by-the.626635
watch: all roads lead to.../articles/view/20161001/local/watch-all-roads-lead-to-valletta-for-notte-bianca.626646
videos/videos
video on demand/video-on-demand
victor callejaa journalist dies in.../articles/author/24
vehicles for sale/classifieds/vehicles-for-sale
trump's tax writeoff shows his 'genius'.../articles/view/20161002/world/trumps-tax-writeoff-shows-his-genius-at-business-advisers-say.626799
travel/sections/view/travel
toni abela, ministry consultant apply to.../articles/view/20161002/local/toni-abela.626655
to let/classifieds/to-let
timestalk/sections/view/timestalk
times of malta homepage/
the zone/thezone
the net neutrality debate/articles/view/20161002/business-news/the-net-neutrality-debate.626735
the end of the malta railway/articles/view/20161002/life-features/the-end-of-the-malta-railway.626750

KEYWORDS STATISTICS

Keyword Using Count Usage Rate(%)
more16 times2.09
news11 times1.44
yesterday10 times1.31
malta8 times1.05
business7 times0.92
sale6 times0.79
manager6 times0.79
your5 times0.65
health5 times0.65
into5 times0.65
advert4 times0.52
premium4 times0.52
national4 times0.52
world4 times0.52
sport4 times0.52
comment4 times0.52
features4 times0.52
opinion4 times0.52
letters4 times0.52
blogs4 times0.52
life4 times0.52
escape4 times0.52
property4 times0.52
careers4 times0.52
finance4 times0.52

META TAGS

apple-itunes-appapp-id=884947837
apple-itunes-app-tabapp-id=884947837
authorallied newspapers ltd
content-typetext/html; charset=utf-8
fb:app_id356697991023219
google-play-appapp-id=com.timesofmalta.timesofmalta
google-play-app-tabapp-id=com.timesofmalta.timesofmalta
msapplication-idapp
msapplication-packagefamilynamealliednewspapersltd.timesofmalta_xc12w5ay2ynxc
msapplication-tileimagehttp://wscont1.apps.microsoft.com/winstore/1x/5ee7e1ed-c232-49b6-b3c2-f0ea4c80207a/icon.411515.png
msapplication-winphonepackageurldb003e19-c644-4293-9e36-690a8082570c
og:imagehttps://cdn-attachments.timesofmalta.com/default-article-image.png
og:site_nametimes of malta

RESPONSE INFO

CF-RAY2ebc8ef9917d1037-CDG
Connectionkeep-alive
Content-Typetext/html; charset=UTF-8
DateMon, 03 Oct 2016 01:18:09 GMT
P3PCP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
Servercloudflare-nginx
Transfer-Encodingchunked
VaryAccept-Encoding

H TAGS

h2‘no wrong in bov businessman loan’, business, careers, cartoons, classifieds, comment, england manager announces squad for malta match, escape, feedme, fuel prices down, pn says the reduction is too little, gasan has his say: ‘tarnishing our name is not fair’, health, latest blogs, latest videos, life, national, news, odd news, opinion, poll, premium articles, services, sign in, sport, world news,
h3administrator (pensions), boards do better when women are aboard, brexit talks to start by march, britons terrified of being taken over by robots, busuttil insists people will benefit..., city lose 100 percent record in defeat at tottenham, close the hunting season? why?, do you want your 16-year-old to have the vote?, doctors don't communicate well about..., finance officer - banking, good night lights cheer up sick children, greed 1, england 0, hamilton demands answers from mercedes..., highest weekly gain in mse index for..., history of agriculture in malta, hormonal contraception linked to..., how to kill st julian’s bay, hungarian migration referendum flops on..., hungarians set to reject migrant quotas..., 'i beheaded them, i cooked their heads'..., immunotherapy: medicine’s new hope, in defence of the shopaholic, incentives for us currency firm kept..., investment assistant, low rates needed for higher rates in..., malta, our common home, mediterranean diet could prevent..., myth debunked: it takes seven years to..., napoli lose unbeaten record, higuain..., oops, my phone exploded, or sign in with facebook or google, pensions admin team leader, pope: no more violence in god's name, rock of ages: don’t stop believing!, romanian couples get cash reward for..., safe pair of hands vs populism, sales & business development officers, short film festival at villa bologna, simply fantastic, stoke's allen strikes late to deny man..., students' bus card offers three-month..., students shine at the stagecoach summer short play festival, the end of the malta railway, the net neutrality debate, toni abela, ministry consultant apply to..., trump's tax writeoff shows his 'genius'..., use your timesofmalta.com account to login:, watch: man destroys iphones at apple..., what is fitness, exactly?, what students want, wisdom of the heart,
h4popup, what are you hungry for?,

JAVASCRIPT FILES

1/min/a.js?v=407
2/min/b.js?v=407
3/min/c.js?v=407
4/min/d.js?v=407
5/min/s.js?v=407

CSS FILES

1/css/../js/vendors/jquery-news-ticker/styles/custom.css
2/favicon.ico?1
3/min/global.css?v=407
4/min/main.css?v=407
5/min/print.css?v=407
6/mobile
7/rss
8https://cdn-attachments.timesofmalta.com/default-article-image.png